PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001695m
Common NameCARUB_v10001695mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 274aa    MW: 31083.8 Da    PI: 7.6267
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001695mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.99.7e-083075346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a + +  +   +W ++a++++ g+t  ++   + k
  Carubv10001695m 30 SWTKEENKKFERALAVYADDtpdRWFKVAAMIP-GKTISDVMRQYSK 75
                     7*****************99*************.******9998877 PP

2Myb_DNA-binding409.2e-13132176347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
  Carubv10001695m 132 PWTEEEHRRFLLGLLKYGKGDWRNISRNFVGSKTPTQVASHAQKY 176
                      8****************************999************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.8222679IPR017884SANT domain
SMARTSM007178.7E-82779IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-42774IPR009057Homeodomain-like
SuperFamilySSF466897.18E-112983IPR009057Homeodomain-like
PfamPF002491.1E-63075IPR001005SANT/Myb domain
CDDcd001671.90E-73076No hitNo description
PROSITE profilePS5129418.108125181IPR017930Myb domain
SuperFamilySSF466891.08E-15127180IPR009057Homeodomain-like
SMARTSM007179.9E-11129179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-11129181IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-16129180IPR006447Myb domain, plants
PfamPF002493.9E-10132176IPR001005SANT/Myb domain
CDDcd001677.01E-10132176No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
METLHPLLSH VPTSDHRFVV QEMMCLQGSS WTKEENKKFE RALAVYADDT PDRWFKVAAM  60
IPGKTISDVM RQYSKLEEDL FDIEAGLVPI PGYRSTPCGF DDQFVSQRDF DAYRKLPNGA  120
RGFDQDRRKG VPWTEEEHRR FLLGLLKYGK GDWRNISRNF VGSKTPTQVA SHAQKYYQRQ  180
LSGAKDKRRP SIHDITTVNL LNANPNRPSS DQGCFASSQQ ADPKQEFTHK ENAEERVMFL  240
GQNLSSVLSP YDPTFNFAGA NVYSDGGYTI TIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-182896876RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00489DAPTransfer from AT5G05790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195310.0AY519531.1 Arabidopsis thaliana MYB transcription factor (At5g05790) mRNA, complete cds.
GenBankBT0260540.0BT026054.1 Arabidopsis thaliana At5g05790 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288437.10.0hypothetical protein CARUB_v10001695mg
SwissprotQ8S9H76e-73DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0H8S80.0R0H8S8_9BRAS; Uncharacterized protein
STRINGAT5G05790.11e-179(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05790.10.0MYB family protein